PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g23710.1.p
Common NameBRADI_2g23710, LOC100826230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 302aa    MW: 32874.8 Da    PI: 6.8634
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g23710.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.91.9e-073073344
                      SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
   Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                      +W++ E +l+ +a ++  g+   +W+++a+ ++ g++  ++  ++
  Bradi2g23710.1.p 30 AWSPAENKLFEEALARVDGDapgRWERVAALLP-GKSVADVMAHY 73
                      7********************************.********999 PP

2Myb_DNA-binding45.71.5e-14142186347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE++l++ + k++G g+W+ I+r + + Rt+ q+ s+ qky
  Bradi2g23710.1.p 142 PWTEEEHKLFLMGLKKYGRGDWRNISRNFVTSRTPTQVASHAQKY 186
                       8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.0232680IPR017884SANT domain
SMARTSM007173.2E-52779IPR001005SANT/Myb domain
SuperFamilySSF466891.44E-82982IPR009057Homeodomain-like
PfamPF002494.8E-63073IPR001005SANT/Myb domain
CDDcd001678.09E-63073No hitNo description
PROSITE profilePS5129417.568135191IPR017930Myb domain
SuperFamilySSF466891.35E-17137191IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-17138189IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.0E-12139185IPR009057Homeodomain-like
SMARTSM007175.8E-13139189IPR001005SANT/Myb domain
PfamPF002496.9E-12142186IPR001005SANT/Myb domain
CDDcd001671.83E-11142187No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MMKESWMEVL PLPPAPYLAG GWFLQEQQRA WSPAENKLFE EALARVDGDA PGRWERVAAL  60
LPGKSVADVM AHYDDLENDV GFIEAGLVPF PQYNGGGGGS PASGFTLDWD GGGDDLAFKR  120
SCYIVGGKRA RGPDQERKKG VPWTEEEHKL FLMGLKKYGR GDWRNISRNF VTSRTPTQVA  180
SHAQKYFIRL NSGGKDKRRS SIHDITTVNI PDDDHGSNPS PSPPSSVLTP NSSSGAAPPA  240
ISEQFGVLVD SKPQISRGGH HHFIPHLYGN VKLEASNGYH GGRLDDSVLM QMQCGQLQPL  300
G*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A6e-152998978RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0947400.0FP094740.1 Phyllostachys edulis cDNA clone: bphylf046m24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568340.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H73e-82DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLI1HIW60.0I1HIW6_BRADI; Uncharacterized protein
STRINGBRADI2G23710.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22743796
Representative plantOGRP27517122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.13e-79MYB family protein